PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.4G142300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 304aa    MW: 32199.9 Da    PI: 6.3661
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.4G142300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.8e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd +l+ +   +G+g+W+ ++++ g++R++k+c++r+ +yl
  Sevir.4G142300.1.p 14 KGPWTPEEDAKLLAYTSTHGTGNWTNVPQRAGLKRCGKSCRLRYTNYL 61
                        79********************************************97 PP

2Myb_DNA-binding51.91.8e-1669110346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         ++T+eE++l+v ++++lG++ W++Ia+ ++ gRt++++k++w++
  Sevir.4G142300.1.p  69 NFTQEEEDLIVTLHAMLGSR-WSLIANQLP-GRTDNDVKNYWNT 110
                         89******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-24565IPR009057Homeodomain-like
PROSITE profilePS5129417.415961IPR017930Myb domain
SuperFamilySSF466892.25E-3011108IPR009057Homeodomain-like
SMARTSM007172.4E-141363IPR001005SANT/Myb domain
PfamPF002491.5E-151461IPR001005SANT/Myb domain
CDDcd001672.05E-111661No hitNo description
PROSITE profilePS5129424.53262116IPR017930Myb domain
SMARTSM007178.5E-1566114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2366116IPR009057Homeodomain-like
PfamPF002496.3E-1569110IPR001005SANT/Myb domain
CDDcd001673.64E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MGRPPCCDKA NVKKGPWTPE EDAKLLAYTS THGTGNWTNV PQRAGLKRCG KSCRLRYTNY  60
LRPNLKHENF TQEEEDLIVT LHAMLGSRWS LIANQLPGRT DNDVKNYWNT KLSKKLRQRG  120
IDPITHRPIA DLMHSIGALA IRPPQPAPSP NGSSSASSYL PAPALPLVHD VAYHAAGILP  180
PPPPHQQQVV IARVDADAPA SPAADHGQQL KWSDFLADDA AAAFEAQYHH DASVAAHGGG  240
GGSILAAGSS SAGGGDDDAA AFIDAILDCD KETGVDQLIA ELLADPAYYA GSSSSSSEMG  300
WGC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0854910.0BT085491.1 Zea mays full-length cDNA clone ZM_BFc0020H06 mRNA, complete cds.
GenBankEU9670890.0EU967089.1 Zea mays clone 299414 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965547.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLB6TQ241e-166B6TQ24_MAIZE; DNA binding protein
STRINGGRMZM2G308034_P011e-166(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118743439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-65myb domain protein 103